PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK34478.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 1656aa    MW: 181595 Da    PI: 6.8877
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK34478.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.52.1e-10871912346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT +E e +++  +++G++ +k+Ia+++   +t  +c+++++k
       KFK34478.1 871 PWTSDEKETFLNMLALHGKD-FKKIASYLT-QKTTADCIDYYYK 912
                      8*****************99.********9.9**********98 PP

2Myb_DNA-binding25.33.6e-0810871128447
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding    4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                       WT +E   ++++  ++G++ +++I+r +  +R+  qc+ ++ k+
       KFK34478.1 1087 WTDDERSAFIQGLSLYGKN-FASISRFVR-TRSQDQCRVFYSKV 1128
                       *****************99.*********.********999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.72E-14854916IPR009057Homeodomain-like
PROSITE profilePS5129315.154867918IPR017884SANT domain
SMARTSM007179.3E-9868916IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-6871913IPR009057Homeodomain-like
PfamPF002491.6E-8871912IPR001005SANT/Myb domain
CDDcd001672.40E-7871913No hitNo description
PROSITE profilePS5129312.41310821133IPR017884SANT domain
SMARTSM007172.4E-710831131IPR001005SANT/Myb domain
SuperFamilySSF466891.64E-910861133IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-510861128IPR009057Homeodomain-like
CDDcd001672.68E-610871128No hitNo description
PfamPF002491.6E-610871128IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1656 aa     Download sequence    Send to blast
MPQDHASWDR KELLRQRKHK RPEPYFDSDF RWRDSPTTPS SHHAPRDFSR WDSGDFRRPS  60
SCHGKQGGRH QFVEETSHGY TSSRSSARMF ENDYYRPSAS RGDWRYTRNC RDDRVPLSHK  120
DWKCNTWDMS NGSSRGFERP CGIRNGRRSV DERPPHASDT HATPVNSWDP ANSTHQPDVA  180
VCTPLRTHKL KNEQKFSDQR LSLPSDPHSD CLSLFERPSS ENNYGNKACS PAKQCNDLIY  240
GRRLANDNSL DPPIPKAELE GTWEQLHLKT PQDNGLHGVS DVDGGRKSGK ESSLGAIGKL  300
PAWTGSGSFA SQSSSFSHSS SLKSLGAVDS SDRKNEILPK IVAVTQSSSG DATACATTTH  360
LTDEMSSRKK QRLGWGEGLA KYEKKKVDVN TNEDGTTLLE NGMEELHSPN KNTADISPTS  420
AFIPDYGSPT TPSSVACSSS PGFADKSSAK AVTAVSDVSN MCRSPSPVSS IHVEQFPINI  480
EELDNISMER FGCLLSELVG TDDPGTGDSS SVFLTSMNRL LAWKGDILKA VEMMESEIDL  540
LETKHKMLKL EGGRRCHVVV PSSYLCEGSE NVPKEQEASC SFGPKAAASS VAETLARDPV  600
HQAVLAKIPV DVFEDSPVEV QSLPKSLATI DSDEDMLRIT AVKEAASSKE INTSTFANLE  660
TIELSSGDDN LASNDDLLCA KLLSSNKKYA IESSEVFNEL LPRNFSTIDD PRFPGIGQRQ  720
FDSHVNEKIA DRMELLRARE KILLLQFKAF QLSWKKDLRQ LALTKYQSKS YKKTELYPNA  780
KNSGHLRLPQ PVRLRLSSSA PRRDSVAPTT ELVSYMEKLL PGIRLKPLRD NLIMPAMILD  840
EKERVMSRFI SSNGLIEDPC DAEKERTMIN PWTSDEKETF LNMLALHGKD FKKIASYLTQ  900
KTTADCIDYY YKNHKSDSFG KIKKQRAFGK EGKHTYMLAP RKKWKREMGA ASLDILGAVS  960
IIAANAGKVA STRQISSKRI TLRGCSSSNS LQHDGNNSEG CSYSLDFPRK RTVGADVLAV  1020
GPLSSEQINS CMRTSVNSKE ERCMDHLKLD PVVKKPRISH TTHNENSNEE DDSCSEESCG  1080
ETGPIHWTDD ERSAFIQGLS LYGKNFASIS RFVRTRSQDQ CRVFYSKVRK CLGLESIQSG  1140
SGNVSTSASV DNGNEGGGSD LEDPCAMESN SGICNNGVCA KMGLNSPTSP FNMNQEGANH  1200
SGSANVKASL SRSEQENGPT YLCLKDGTNL VNNASINGGS PGLVSESCRD LIDINTVESQ  1260
SQAAGKIKSN DLLSMEIDEG NLTSVAVSSD PLYCGSSVLS NVVVETPRES LQKCSGGQGA  1320
ALPKHGSKNQ DGVMQAANRT RNSGLEAETA PSSFKYPECL HHVPIVVSTG DPVGVSVPQG  1380
NPKCHTESES PNSLVGQFVK TNNLGWQFSK VDLDLDGRLQ VLGHVYPEQN GQLNATNTEA  1440
SQIPRISFMH DPSRISRSKS DLIVKTQRTG EGFSLNKCTS SATKPLTVIH KDGRSGHSRS  1500
HSFSLCDTER IDKNGDVKLF GTVLTADENG SKQQDNQGGN IFRSSSTLSR DHDTRHQYIN  1560
QQHLQNVPIT SYGFWDGNRI QTGLTSLPES AKLLASYPEA FSMHLQQQVG NSKEILLDVN  1620
GGILSFGRHI EDRAEASSGK DEGNIVGIDG VAEAAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D2e-16828919393NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C2e-16828919393NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF5469830.0HF546983.1 Arabis alpina myb gene for myb like transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006403821.10.0hypothetical protein EUTSA_v10010054mg
TrEMBLA0A087GX760.0A0A087GX76_ARAAL; Uncharacterized protein
STRINGscaffold_502292.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein